Recombinant Rat Cxcl12 protein
Cat.No. : | Cxcl12-111R |
Product Overview : | Recombinant Rat Cxcl12 beta protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | Non |
Protein Length : | 72 |
Description : | CXCL12 also known as SDF-1 is belonging to the CXC chemokine family. Rat CXCL12 is expressed as two isoforms that differ only in the C-terminal tail. And both SDF-1 isoforms undergo proteolytic processing of the first two N-terminal amino acids. In all SDF-1 isoforms, SDF-1β is the canonical sequence. It has the complete amino acids in the C-terminal tail. On the cell surface, the receptor for this chemokine is CXCR4 and syndecan4. CXCL12 is strongly chemotactic for T-lymphocytes, monocytes, but not neutrophils. SDF-1 is highly conserved between species, murine CXCL12β shares approximately 96 % amino acid sequence identity with human CXCL12β. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 150 mM NaCl. |
Bio-activity : | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood monocytes is in a concentration range of 100-200 ng/ml. |
Molecular Mass : | Approximately 8.4 kDa, a single non-glycosylated polypeptide chain containing 72 amino acids. |
AA Sequence : | KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKSNNRQVCIDPKLKWIQEYLDKALNKRLKM |
Endotoxin : | Less than 1 EU/μg of rRtSDF-1β/CXCL12β as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Cxcl12 |
Official Symbol | Cxcl12 |
Synonyms | CXCL12; chemokine (C-X-C motif) ligand 12; SDF-1 gamma; Stromal cell-derived factor 1; stromal cell-derived factor-1 gamma; chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1); Sdf1; |
Gene ID | 24772 |
mRNA Refseq | NM_001033882 |
Protein Refseq | NP_001029054 |
UniProt ID | Q9QZD1 |
◆ Recombinant Proteins | ||
ACVRL1-9359H | Recombinant Human ACVRL1 protein, GST-tagged | +Inquiry |
CXCL12-031H | Recombinant Human CXCL12 Protein | +Inquiry |
CXCL12-1107R | Recombinant Rhesus monkey CXCL12 Protein, His-tagged | +Inquiry |
Cxcl12-2510M | Recombinant Mouse Cxcl12 protein, His-tagged | +Inquiry |
Cxcl12-42M | Recombinant Mouse Cxcl12 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL12-3016HCL | Recombinant Human CXCL12 cell lysate | +Inquiry |
CXCL12-1863CCL | Recombinant Cynomolgus CXCL12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cxcl12 Products
Required fields are marked with *
My Review for All Cxcl12 Products
Required fields are marked with *
0
Inquiry Basket