Recombinant Human CXCL12 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CXCL12-5382H
Product Overview : CXCL12 MS Standard C13 and N15-labeled recombinant protein (NP_954637) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This antimicrobial gene encodes a stromal cell-derived alpha chemokine member of the intercrine family. The encoded protein functions as the ligand for the G-protein coupled receptor, chemokine (C-X-C motif) receptor 4, and plays a role in many diverse cellular functions, including embryogenesis, immune surveillance, inflammation response, tissue homeostasis, and tumor growth and metastasis. Mutations in this gene are associated with resistance to human immunodeficiency virus type 1 infections. Multiple transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 9.9 kDa
AA Sequence : MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CXCL12 C-X-C motif chemokine ligand 12 [ Homo sapiens (human) ]
Official Symbol CXCL12
Synonyms CXCL12; chemokine (C-X-C motif) ligand 12; SDF1, SDF1A, SDF1B, stromal cell derived factor 1; stromal cell-derived factor 1; PBSF; SCYB12; SDF 1a; SDF 1b; TLSF a; TLSF b; TPAR1; intercrine reduced in hepatomas; pre-B cell growth-stimulating factor; IRH; SDF1; TLSF; SDF1A; SDF1B;
Gene ID 6387
mRNA Refseq NM_199168
Protein Refseq NP_954637
MIM 600835
UniProt ID P48061

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CXCL12 Products

Required fields are marked with *

My Review for All CXCL12 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon