Recombinant Mouse Cxcl12 protein, His-tagged

Cat.No. : Cxcl12-2510M
Product Overview : Recombinant Mouse Cxcl12 protein(1-89 aa), fused to His tag, was expressed in E. coli.
Availability March 09, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 1-89 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : VVAVLALVLAALCISDGKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name Cxcl12 chemokine (C-X-C motif) ligand 12 [ Mus musculus ]
Official Symbol Cxcl12
Synonyms CXCL12; chemokine (C-X-C motif) ligand 12; stromal cell-derived factor 1; C-X-C motif chemokine 12; pre-B cell growth-stimulating factor; pre-B-cell growth-stimulating factor; thymic lymphoma cell-stimulating factor; 12-O-tetradecanoylphorbol 13-acetate repressed protein 1; Pbsf; Sdf1; Tlsf; Sdf1a; Sdf1b; Tlsfa; Tlsfb; Tpar1; Scyb12; AI174028;
Gene ID 20315
mRNA Refseq NM_001012477
Protein Refseq NP_001012495

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Cxcl12 Products

Required fields are marked with *

My Review for All Cxcl12 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon