Recombinant Human CTSZ
Cat.No. : | CTSZ-27236TH |
Product Overview : | Recombinant full length Human Cathepsin Z with a N terminal proprietary tag. Predicted MW 59.40kDa |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
ProteinLength : | 303 amino acids |
Description : | The protein encoded by this gene is a lysosomal cysteine proteinase and member of the peptidase C1 family. It exhibits both carboxy-monopeptidase and carboxy-dipeptidase activities. The encoded protein has also been known as cathepsin X and cathepsin P. This gene is expressed ubiquitously in cancer cell lines and primary tumors and, like other members of this family, may be involved in tumorigenesis. |
Molecular Weight : | 59.400kDa inclusive of tags |
Tissue specificity : | Widely expressed. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MARRGPGWRPLLLLVLLAGAAQGGLYFRRGQTCYRPLRGD GLAPLGRSTYPRPHEYLSPADLPKSWDWRNVDGVNYASIT RNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSV QNVIDCGNAGSCEGGNDLSVWDYAHQHGIPDETCNNYQAK DQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGRE KMMAEIYANGPISCGIMATERLANYTGGIYAEYQDTTYIN HVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTY KDGKGARYNLAIEEHCTFGDPIV |
Sequence Similarities : | Belongs to the peptidase C1 family. |
Gene Name | CTSZ cathepsin Z [ Homo sapiens ] |
Official Symbol | CTSZ |
Synonyms | CTSZ; cathepsin Z; CTSX; |
Gene ID | 1522 |
mRNA Refseq | NM_001336 |
Protein Refseq | NP_001327 |
MIM | 603169 |
Uniprot ID | Q9UBR2 |
Chromosome Location | 20q13.32 |
Pathway | Clathrin derived vesicle budding, organism-specific biosystem; Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; Lysosome Vesicle Biogenesis, organism-specific biosystem; Membrane Trafficking, organism-specific biosystem; |
Function | cysteine-type endopeptidase activity; cysteine-type peptidase activity; peptidase activity; |
◆ Recombinant Proteins | ||
NPRL3-3149Z | Recombinant Zebrafish NPRL3 | +Inquiry |
GERE-0197B | Recombinant Bacillus subtilis GERE protein, His-tagged | +Inquiry |
GUCY2D-2757R | Recombinant Rat GUCY2D Protein | +Inquiry |
FCGR3A-2456H | Recombinant Human FCGR3A Protein (Gly17-Gln208), C-His tagged | +Inquiry |
ANAPC10-2092HFL | Recombinant Full Length Human ANAPC10 Protein, C-Flag-tagged | +Inquiry |
◆ Native Proteins | ||
PGC-8318H | Native Human PGC | +Inquiry |
LCN2-384H | Native Human LCN2 | +Inquiry |
PTI-1900B | Native Bovine Pancreatic Trypsin Inhibitor | +Inquiry |
SAA-256H | Native Human Serum amyloid A Protein | +Inquiry |
Lectin-1848S | Active Native Soybean Agglutinin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NID1-3829HCL | Recombinant Human NID1 293 Cell Lysate | +Inquiry |
MRI1-4202HCL | Recombinant Human MRI1 293 Cell Lysate | +Inquiry |
UBE2H-575HCL | Recombinant Human UBE2H 293 Cell Lysate | +Inquiry |
DLG3-6911HCL | Recombinant Human DLG3 293 Cell Lysate | +Inquiry |
HIST1H4C-329HCL | Recombinant Human HIST1H4C lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CTSZ Products
Required fields are marked with *
My Review for All CTSZ Products
Required fields are marked with *
0
Inquiry Basket