Recombinant Rat Csf3 protein
Cat.No. : | Csf3-9291R |
Product Overview : | Recombinant Rat Csf3 protein was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | Non |
Protein Length : | 195 |
Description : | The protein is a putative hematopoetic growth factor for neutrophils, and wase used as a treatment for cyclic hematopoesis in humans and dogs. |
Form : | Lyophilized from a 0.2 μm filtered concentrated solution in 5 mM Sodium Citrate, pH 4.0. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 determined by a cell proliferation assay using murine NFS-60 cells is less than 0.05 ng/ml, corresponding to a specific activity of > 2.0 × 10⁷ IU/mg. |
Molecular Mass : | Approximately 21.5 kDa, a single non-glycosylated polypeptide chain containing 195 amino acids. |
AA Sequence : | KKIPLLTVSSLPPSLPLPRSFLLKSLEQVRKIQARNTELLEQLCATYKLCHPEELVLFGHSLGIPKASLSSCSSQALQQTKCLSQLHSGLFLYQGLLQALAGISSELAPTLDMLHLDVDNFATTIWQQMESLGVAPTVQPTQSTMPIFTSAFQRRAGGVLVTSYLQSFLETAHHALHHLPRPAQKHFPESLFISI |
Endotoxin : | Less than 0.1 EU/μg of rRtG-CSF as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analyses. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Csf3 |
Official Symbol | Csf3 |
Synonyms | CSF3; colony stimulating factor 3 (granulocyte); granulocyte colony-stimulating factor; |
Gene ID | 25610 |
mRNA Refseq | NM_017104 |
Protein Refseq | NP_058800 |
UniProt ID | P97712 |
◆ Recombinant Proteins | ||
Csf3-273M | Active Recombinant Mouse Colony Stimulating Factor 3 (Granulocyte) | +Inquiry |
CSF3-178H | Active Recombinant Human CSF3 Protein | +Inquiry |
CSF3-250H | Recombinant Human CSF3, StrepII-tagged | +Inquiry |
CSF3-6831C | Recombinant Chicken CSF3 | +Inquiry |
CSF3-387R | Recombinant Rhesus CSF3 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSF3-2948HCL | Recombinant Human CSF3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Csf3 Products
Required fields are marked with *
My Review for All Csf3 Products
Required fields are marked with *
0
Inquiry Basket