Recombinant Rat Csf3 protein

• Cat.No.: Csf3-9291R
• Product Overview: Recombinant Rat Csf3 protein was expressed in E.coli.

Specification

• Species: Rat
• Source: E.coli
• Tag: Non
• Protein Length: 195
• Description: The protein is a putative hematopoetic growth factor for neutrophils, and wase used as a treatment for cyclic hematopoesis in humans and dogs.
• Form: Lyophilized from a 0.2 μm filtered concentrated solution in 5 mM Sodium Citrate, pH 4.0.
• Bio-activity: Fully biologically active when compared to standard. The ED50 determined by a cell proliferation assay using murine NFS-60 cells is less than 0.05 ng/ml, corresponding to a specific activity of > 2.0 × 10⁷ IU/mg.
• Molecular Mass: Approximately 21.5 kDa, a single non-glycosylated polypeptide chain containing 195 amino acids.
• AA Sequence: KKIPLLTVSSLPPSLPLPRSFLLKSLEQVRKIQARNTELLEQLCATYKLCHPEELVLFGHSLGIPKASLSSCSSQALQQTKCLSQLHSGLFLYQGLLQALAGISSELAPTLDMLHLDVDNFATTIWQQMESLGVAPTVQPTQSTMPIFTSAFQRRAGGVLVTSYLQSFLETAHHALHHLPRPAQKHFPESLFISI
• Endotoxin: Less than 0.1 EU/μg of rRtG-CSF as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analyses.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Csf3
• Official Symbol: Csf3
• Synonyms: CSF3; colony stimulating factor 3 (granulocyte); granulocyte colony-stimulating factor
• Gene ID: 25610
• mRNA Refseq: NM_017104
• Protein Refseq: NP_058800
• UniProt ID: P97712