Active Recombinant Mouse Csf3 Protein

• Cat.No.: Csf3-280C
• Product Overview: Recombinant Mouse Csf3 Protein without tag was expressed in CHO.

Specification

• Species: Mouse
• Source: CHO
• Description: Granulocyte Colony-Stimulating Factor (G-CSF), also known as CSF-3 and MGI-1G, is a cytokine and hormone belonging to the IL-6 superfamily. It is expressed by monocytes, macrophages, endothelial cells, fibroblasts and bone marrow stroma. G-CSF stimulates the bone marrow to produce granulocytes and stem cells, and specifically stimulates the proliferation and differentiation of the neutrophilic granulocyte lineage. G-CSF has been used to stimulate white blood cell production after chemotherapy. It has also been used to boost the number of hematopoietic stem cells after bone marrow transplantation.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 0.02 ng/mL, measured in a cell proliferation assay using NFS-60 cells.
• Molecular Mass: 22-24 kDa, observed by reducing SDS-PAGE.
• AA Sequence: VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Storage: Lyophilized recombinant murine G-CSF remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, murine G-CSF should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: Csf3 colony stimulating factor 3 (granulocyte) [ Mus musculus ]
• Official Symbol: Csf3
• Synonyms: CSF3; colony stimulating factor 3 (granulocyte); granulocyte colony-stimulating factor; Csfg; G-CSF; MGI-IG
• Gene ID: 12985
• mRNA Refseq: NM_009971
• Protein Refseq: NP_034101
• UniProt ID: P09920