Active Recombinant Mouse Csf3 Protein
Cat.No. : | Csf3-280C |
Product Overview : | Recombinant Mouse Csf3 Protein without tag was expressed in CHO. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | CHO |
Description : | Granulocyte Colony-Stimulating Factor (G-CSF), also known as CSF-3 and MGI-1G, is a cytokine and hormone belonging to the IL-6 superfamily. It is expressed by monocytes, macrophages, endothelial cells, fibroblasts and bone marrow stroma. G-CSF stimulates the bone marrow to produce granulocytes and stem cells, and specifically stimulates the proliferation and differentiation of the neutrophilic granulocyte lineage. G-CSF has been used to stimulate white blood cell production after chemotherapy. It has also been used to boost the number of hematopoietic stem cells after bone marrow transplantation. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 0.02 ng/mL, measured in a cell proliferation assay using NFS-60 cells. |
Molecular Mass : | 22-24 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE and HPLC. |
Storage : | Lyophilized recombinant murine G-CSF remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, murine G-CSF should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | Csf3 colony stimulating factor 3 (granulocyte) [ Mus musculus ] |
Official Symbol | Csf3 |
Synonyms | CSF3; colony stimulating factor 3 (granulocyte); granulocyte colony-stimulating factor; Csfg; G-CSF; MGI-IG; |
Gene ID | 12985 |
mRNA Refseq | NM_009971 |
Protein Refseq | NP_034101 |
UniProt ID | P09920 |
◆ Recombinant Proteins | ||
CSF3-032H | Recombinant Human CSF3 Protein | +Inquiry |
CSF3-30H | Active Recombinant Human CSF3 Protein (Thr31-Pro204), N-His tagged, Animal-free, Carrier-free | +Inquiry |
CSF3-178H | Active Recombinant Human CSF3 Protein | +Inquiry |
Csf3-047M | Active Recombinant Mouse Csf3 Protein | +Inquiry |
CSF3-142H | Active Recombinant Human Colony Stimulating Factor 3 (Granulocyte) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSF3-2948HCL | Recombinant Human CSF3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Csf3 Products
Required fields are marked with *
My Review for All Csf3 Products
Required fields are marked with *
0
Inquiry Basket