Recombinant Human CSF3
Cat.No. : | CSF3-26467TH |
Product Overview : | Recombinant full length human G-CSF protein expressed in modified human 293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Non |
Description : | The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of granulocytes. The active protein is found extracellularly. Alternatively spliced transcript variants have been described for this gene. |
Biological activity : | The ED50 of CSF3-26467TH is typically 0.01 - 0.03 ng/ml as measured in a cell proliferation assay using a murine myeloblastic M-NFS-60 cell line. |
Form : | Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not reco |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin |
Storage : | Store at +4°C. |
Sequences of amino acids : | Theoretical Sequence:ATPLGPASSLPQSFLLKCLEQVRKIQGDG AALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPS QALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTL QLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAF QRRAGGVLVASHLQSFLEVSYRVLRHLAQP |
Sequence Similarities : | Belongs to the IL-6 superfamily. |
Full Length : | Full L. |
Gene Name | CSF3 colony stimulating factor 3 (granulocyte) [ Homo sapiens ] |
Official Symbol | CSF3 |
Synonyms | CSF3; colony stimulating factor 3 (granulocyte); C17orf33, chromosome 17 open reading frame 33 , G CSF, GCSF; granulocyte colony-stimulating factor; filgrastim; granulocyte colony stimulating factor; lenograstim; MGC45931; pluripoietin; |
Gene ID | 1440 |
mRNA Refseq | NM_000759 |
Protein Refseq | NP_000750 |
MIM | 138970 |
Uniprot ID | P09919 |
Chromosome Location | 17q11.2-q12 |
Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytokines and Inflammatory Response, organism-specific biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; |
Function | cytokine activity; cytokine activity; enzyme binding; granulocyte colony-stimulating factor receptor binding; growth factor activity; |
◆ Recombinant Proteins | ||
CSF3-281C | Active Recombinant Human CSF3 Protein | +Inquiry |
Csf3-273M | Active Recombinant Mouse Colony Stimulating Factor 3 (Granulocyte) | +Inquiry |
CSF3-3348H | Recombinant Human CSF3 Protein, MYC/DDK-tagged | +Inquiry |
CSF3-600H | Active Recombinant Human CSF3 Protein | +Inquiry |
Csf3-91M | Recombinant Mouse Csf3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSF3-2948HCL | Recombinant Human CSF3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CSF3 Products
Required fields are marked with *
My Review for All CSF3 Products
Required fields are marked with *
0
Inquiry Basket