Recombinant Rat Csf1
Cat.No. : | Csf1-15R |
Product Overview : | Recombinant Rat Macrophage colony-stimulating factor 1/MCSF/Csf1 produced by transfected human cells is a secreted protein with sequence (Gln33-Arg254) of Rat MCSF. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | Human Cells |
Tag : | Non |
Protein Length : | 33-254 a.a. |
Description : | Rat Macrophage colony-stimulating factor 1(MCSF,CSF1) is a single-pass type I membrane cytokine. It is a hematopoietic growth factor that plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. MCSF promotes the release of proinflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. It is involved in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone development which for normal male and female fertility. It promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration. MCSF also plays a role in lipoprotein clearance. |
Form : | Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4 |
AA Sequence : | EVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMR FKDNTPNANATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKD WNIFSKNCNDSFAKCSSRDVVTKPDCNCLYPKATPSSDLASASPHQPPAPSMAPLADLAWDDSQR TEGSSLLPSDLPLRIEDPGSAKQRPPR |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at < -20ºC, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7ºC for 2-7 days. Aliquots of reconstituted samples are stable at < -20ºC for 3 months. |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | Csf1 colony stimulating factor 1 (macrophage) [ Rattus norvegicus (Norway rat) ] |
Official Symbol | Csf1 |
Synonyms | Csf1; colony stimulating factor 1 (macrophage); macrophage colony-stimulating factor 1; CSF-1; MCSF; NP_076471.3; EC 2.7.10.1 |
Gene ID | 78965 |
mRNA Refseq | NM_023981 |
Protein Refseq | NP_076471 |
UniProt ID | Q8JZQ0 |
Chromosome Location | 2q34 |
Pathway | Cytokine-cytokine receptor interaction; Cytokines and Inflammatory Response (BioCarta); Hematopoietic cell lineage |
Function | cytokine activity; growth factor activity; macrophage colony-stimulating factor receptor binding |
◆ Recombinant Proteins | ||
CSF1-2160H | Recombinant Human CSF1 Protein, His-tagged | +Inquiry |
Csf1-1106M | Recombinant Mouse Csf1 Protein, His-tagged | +Inquiry |
Csf1-14R | Active Recombinant Rat Csf1 | +Inquiry |
Csf1-333C | Active Recombinant Rat Csf1 Protein (155 aa) | +Inquiry |
CSF1-26835TH | Recombinant Human CSF1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSF1-1934HCL | Recombinant Human CSF1 cell lysate | +Inquiry |
CSF1-001MCL | Recombinant Mouse CSF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Csf1 Products
Required fields are marked with *
My Review for All Csf1 Products
Required fields are marked with *
0
Inquiry Basket