Active Recombinant Rat Csf1 Protein (155 aa)

• Cat.No.: Csf1-333C
• Product Overview: Recombinant Rat Macrophage Colony Stimulating Factor (M-CSF) produced in E. coli is a disulfide-linked homodimer containing two non-glycosylated polypeptide chains of 155 amino acids each. A fully biologically active molecule, rrM-CSF has a molecular mass of 28 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.

Specification

• Description: Macrophage-Colony Stimulating Factor (M-CSF), also known as Colony Stimulating Factor-1 (CSF-1), can stimulate the survival, proliferation and differentiation of mononuclear phagocytes, in addition to the spreading and motility of macrophages. M-CSF is mainly produced by monocytes, macrophages, fibroblasts, and endothelial cells. Interaction of M-CSF with its receptor, c-fms, has been implicated in the growth, invasion, and metastasis of several types of cancer, including breast and endometrial cancer.
• Source: E. coli
• Species: Rat
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 5 ng/mL, measured in a cell proliferation assay using Murine M-NFS-60 cells, corresponding to a specific activity of > 2 × 10^5 units/mg.
• Molecular Mass: 28 kDa, observed by reducing SDS-PAGE.
• Protein length: 155
• AA Sequence: MEVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNANATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSLAKCSSRDVVTKP
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE.
• Storage: Lyophilized recombinant Rat Macrophage Colony Stimulating Factor(M-CSF) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Rat M-CSF should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against 50mM Tris, 150mM NaCl, pH 8.0.
• Reconstitution: Reconstituted in ddH2O at 100 μg/mL.

Gene Information

• Gene Name: Csf1 colony stimulating factor 1 (macrophage) [ Rattus norvegicus ]
• Official Symbol: Csf1
• Synonyms: CSF1; colony stimulating factor 1 (macrophage); macrophage colony-stimulating factor 1; MCSF; CSF-1
• Gene ID: 78965
• mRNA Refseq: NM_023981
• Protein Refseq: NP_076471
• UniProt ID: Q8JZQ0