Recombinant Rat Cnr1 Protein

• Cat.No.: CNR1-1498R
• Product Overview: Recombinant Rat CNR1 Protein without tag was expressed in E. coli.

Specification

• Species: Rat
• Source: E.coli
• Description: Enables cannabinoid receptor activity. Involved in several processes, including positive regulation of acute inflammatory response; regulation of secretion by cell; and response to alkaloid. Located in membrane raft and plasma membrane. Colocalizes with intracellular membrane-bounded organelle. Used to study several diseases, including Parkinsonism; diabetic neuropathy; impotence; obesity; and peptic ulcer disease. Biomarker of status epilepticus. Human ortholog(s) of this gene implicated in obesity; schizophrenia; and type 2 diabetes mellitus. Orthologous to human CNR1 (cannabinoid receptor 1).
• Molecular Mass: 58.9 kDa
• AA Sequence: MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNSPLVPAGDTTNITEFYNKSLSSFKENEENIQCGENFMDMECFMILNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFVDFHVFHRKDSPNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCKKLQSVCSDIFPLIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNTASMHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
• Purity: ≥ 90% by SDS-PAGE
• Storage: Store it at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Lyophilized from 20 mM Tris-HCl, 0.15 M NaCl, 0.05% DDM, 6% Trehalose, pH 8.0.
  The volume before lyophilization is 100 μL/vial.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20/-80 centigrade. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: Cnr1 cannabinoid receptor 1 [ Rattus norvegicus (Norway rat) ]
• Official Symbol: Cnr1
• Synonyms: Cnr1; cannabinoid receptor 1; SKR6R; cannabinoid receptor 1; CB-R; CB1; brain-type cannabinoid receptor; cannabinoid receptor 1 (brain)
• Gene ID: 25248
• mRNA Refseq: NM_012784
• Protein Refseq: NP_036916
• UniProt ID: P20272