Recombinant Rat Ccl22 protein

• Cat.No.: Ccl22-637R
• Product Overview: Recombinant Rat Ccl22 protein was expressed in Escherichia coli.

Specification

• Product Overview: Recombinant Rat Ccl22 protein was expressed in Escherichia coli.
• Description: CCL22 is a protein encoded by the CCL22 gene. It is highly expressed in macrophage, monocyte-derived dendritic cell and thymus, additionally, also detected in the tissues of thymus, lymph node and appendix. CCL22 can bind to CCR4, and is a chemoattractant for monocytes, monocyte-derived dendritic cells, and natural killer cells, but not for neutrophils, eosinophils, and resting T-lymphocytes. After secreted from monocyte-derived dendritic cells, the protein can be proteolytic cleaved into three forms: MDC (3-69), MDC (5-69), MDC (7-69).
• Source: E.coli
• Species: Rat
• Form: Lyophilized from a 0.2μm filtered concentrated solution in 2 × PBS, pH 7.4.
• Bio-activity: Fully biologically active when compared to standard. The biologically active determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 10-100 ng/ml.
• Molecular Mass: Approximately 7.9 kDa, a single, non-glycosylated polypeptide chain containing 68 amino acids.
• Protein length: 68
• AA Sequence: GPYGANVEDSICCQDYIRHPLPPRFVKEFYWTSKSCRKPGVVLITIKNRDICADPRMLWVKKILHKLA
• Endotoxin: Less than 1 EU/µg of rRtMDC/CCL22 as determined by LAL method.
• Purity: >96% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
• Tag: Non

Gene Information

• Gene Name: Ccl22
• Official Symbol: Ccl22
• Synonyms: CCL22; chemokine (C-C motif) ligand 22; C-C motif chemokine 22; small inducible cytokine A22; small inducible cytokine subfamily A (Cys-Cys) member 22; small inducible cytokine subfamily A (Cys-Cys), member 22; Mdc; Scya22; MGC108943
• Gene ID: 117551
• mRNA Refseq: NM_057203
• Protein Refseq: NP_476551
• UniProt ID: Q5I0L5