Recombinant Rat Ccl22 protein
Cat.No. : | Ccl22-637R |
Product Overview : | Recombinant Rat Ccl22 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | Non |
Protein Length : | 68 |
Description : | CCL22 is a protein encoded by the CCL22 gene. It is highly expressed in macrophage, monocyte-derived dendritic cell and thymus, additionally, also detected in the tissues of thymus, lymph node and appendix. CCL22 can bind to CCR4, and is a chemoattractant for monocytes, monocyte-derived dendritic cells, and natural killer cells, but not for neutrophils, eosinophils, and resting T-lymphocytes. After secreted from monocyte-derived dendritic cells, the protein can be proteolytic cleaved into three forms: MDC (3-69), MDC (5-69), MDC (7-69). |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 2 × PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The biologically active determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 10-100 ng/ml. |
Molecular Mass : | Approximately 7.9 kDa, a single, non-glycosylated polypeptide chain containing 68 amino acids. |
AA Sequence : | GPYGANVEDSICCQDYIRHPLPPRFVKEFYWTSKSCRKPGVVLITIKNRDICADPRMLWVKKILHKLA |
Endotoxin : | Less than 1 EU/µg of rRtMDC/CCL22 as determined by LAL method. |
Purity : | >96% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Ccl22 |
Official Symbol | Ccl22 |
Synonyms | CCL22; chemokine (C-C motif) ligand 22; C-C motif chemokine 22; small inducible cytokine A22; small inducible cytokine subfamily A (Cys-Cys) member 22; small inducible cytokine subfamily A (Cys-Cys), member 22; Mdc; Scya22; MGC108943; |
Gene ID | 117551 |
mRNA Refseq | NM_057203 |
Protein Refseq | NP_476551 |
UniProt ID | Q5I0L5 |
◆ Recombinant Proteins | ||
Ccl22-703R | Recombinant Rat Ccl22 protein, His & GST-tagged | +Inquiry |
CCL22-081C | Active Recombinant Human CCL22 Protein (69 aa) | +Inquiry |
CCL22-29602TH | Recombinant Human CCL22 | +Inquiry |
CCL22-67H | Recombinant Human CCL22 protein | +Inquiry |
CCL22-136H | Recombinant Human CCL22, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL22-7728HCL | Recombinant Human CCL22 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ccl22 Products
Required fields are marked with *
My Review for All Ccl22 Products
Required fields are marked with *
0
Inquiry Basket