Recombinant Human CCL22 protein

Product Overview :	Recombinant Human CCL22 protein was expressed in Escherichia coli.
Description :	CCL22 is a protein that in humans is encoded by the CCL22 gene, which locates on the Chr. 16. The protein is highly expressed in macrophage, monocyte-derived dendritic cell and thymus, additionally, also detected in the tissues of thymus, lymph node and appendix. CCL22 can bind to CCR4, and is a chemoattractant for monocytes, monocyte-derived dendritic cells, and natural killer cells, but not for neutrophils, eosinophils, and resting T-lymphocytes. After secreted from monocyte-derived dendritic cells, the protein can be proteolytic cleaved into three forms: MDC (3-69), MDC (5-69), MDC (7-69).
Source :	E.coli
Species :	Human
Form :	Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 500 mM NaCl.
Bio-activity :	Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 10-100 ng/ml.
Molecular Mass :	Approximately 8.1 kDa, a single, non-glycosylated polypeptide chain containing 69 amino acids.
Protein length :	69
AA Sequence :	GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVPWVKMILNKLSQ
Endotoxin :	Less than 1 EU/μg of rHuMDC/CCL22 as determined by LAL method.
Purity :	>97% by SDS-PAGE and HPLC analysis.
Storage :	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution :	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Tag :	Non

Gene Name	CCL22
Official Symbol	CCL22
Synonyms	CCL22; chemokine (C-C motif) ligand 22; SCYA22, small inducible cytokine subfamily A (Cys Cys), member 22; C-C motif chemokine 22; A 152E5.1; ABCD 1; DC/B CK; MDC; MGC34554; STCP 1; MDC(1-69); CC chemokine STCP-1; macrophage-derived chemokine; small inducible cytokine A22; small-inducible cytokine A22; stimulated T cell chemotactic protein 1; stimulated T-cell chemotactic protein 1; small inducible cytokine subfamily A (Cys-Cys), member 22; ABCD-1; SCYA22; STCP-1; DC/B-CK; A-152E5.1;
Gene ID	6367
mRNA Refseq	NM_002990
Protein Refseq	NP_002981
MIM	602957
UniProt ID	O00626