Active Recombinant Human CCL22 Protein (69 aa)
Cat.No. : | CCL22-081C |
Product Overview : | Recombinant Human CCL22 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 69 |
Description : | MDC is a CC chemokine that is produced in B cells, macrophages, monocyte-derived dendritic cells, activated NK cells and CD4 T cells. It signals through the CCR4 receptor. MDC chemoattracts monocytes, dendritic cells and NK cells and exerts HIV suppressive activity. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Fully biologically active when compared to standard. Determined by its ability to chemoattract human T cells using a concentration range of 10.0-100.0 ng/mL, corresponding to a Specific Activity of >1 × 10^4 IU/mg. |
Molecular Mass : | 8.1 kDa, a single, non-glycosylated polypeptide chain containing 69 amino acids. |
AA Sequence : | GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVPWVKMILNKLSQ |
Endotoxin : | Less than 1 EU/mg of rHuMDC/CCL22 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable for several weeks at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH7.4, 500mM NaCl. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | CCL22 chemokine (C-C motif) ligand 22 [ Homo sapiens ] |
Official Symbol | CCL22 |
Synonyms | CCL22; chemokine (C-C motif) ligand 22; SCYA22, small inducible cytokine subfamily A (Cys Cys), member 22; C-C motif chemokine 22; A 152E5.1; ABCD 1; DC/B CK; MDC; MGC34554; STCP 1; MDC(1-69); CC chemokine STCP-1; macrophage-derived chemokine; small inducible cytokine A22; small-inducible cytokine A22; stimulated T cell chemotactic protein 1; stimulated T-cell chemotactic protein 1; small inducible cytokine subfamily A (Cys-Cys), member 22; ABCD-1; SCYA22; STCP-1; DC/B-CK; A-152E5.1; |
Gene ID | 6367 |
mRNA Refseq | NM_002990 |
Protein Refseq | NP_002981 |
MIM | 602957 |
UniProt ID | O00626 |
◆ Recombinant Proteins | ||
Ccl22-131M | Active Recombinant Mouse Ccl22 Protein | +Inquiry |
CCL22-2887M | Recombinant Mouse CCL22 Protein | +Inquiry |
CCL22-112H | Recombinant Human Chemokine (C-C Motif) Ligand 22, His-tagged | +Inquiry |
CCL22-0627H | Recombinant Human CCL22 Protein, GST-Tagged | +Inquiry |
CCL22-18H | Active Recombinant Human CCL22, HIgG1 Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL22-7728HCL | Recombinant Human CCL22 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCL22 Products
Required fields are marked with *
My Review for All CCL22 Products
Required fields are marked with *
0
Inquiry Basket