Recombinant Rat CA1 Protein (2-261 aa), His-SUMO-tagged

Cat.No. : CA1-375R
Product Overview : Recombinant Rat CA1 Protein (2-261 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : His&SUMO
Protein Length : 2-261 aa
Description : Reversible hydration of carbon dioxide.Curated
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 44.2 kDa
AA Sequence : ASADWGYDSKNGPDQWSKLYPIANGNNQSPIDIKTSEAKHDSSLKPVSVSYNPATAKEIVNVGHSFHVVFDDSSNQSVLKGGPLADSYRLTQFHFHWGNSNDHGSEHTVDGAKYSGELHLVHWNSAKYSSAAEAISKADGLAIIGVLMKVGPANPNLQKVLDALSSVKTKGKRAPFTNFDPSSLLPSSLDYWTYFGSLTHPPLHESVTWVICKESISLSPEQLAQLRGLLSSAEGEPAVPVLSNHRPPQPLKGRTVRASF
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name Car1 carbonic anhydrase 1 [ Rattus norvegicus (Norway rat) ]
Official Symbol CA1
Synonyms Ca1; CA-I;
Gene ID 310218
mRNA Refseq NM_001107660
Protein Refseq NP_001101130
UniProt ID B0BNN3

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CA1 Products

Required fields are marked with *

My Review for All CA1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon