Recombinant Rat B2M Protein, His and Strep-tagged

Cat.No. : B2M-105R
Product Overview : Recombinant Rat B2M protein with His and Strep tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : HEK293
Tag : His&Strep
Protein Length : 119
Description : Predicted to enable MHC class II protein complex binding activity and protein homodimerization activity. Involved in response to cadmium ion and response to xenobiotic stimulus. Located in extracellular space. Biomarker of acute kidney failure; pyelonephritis; and ureteral obstruction. Human ortholog(s) of this gene implicated in arthritis; familial visceral amyloidosis; immunodeficiency 43; and inflammatory bowel disease. Orthologous to human B2M (beta-2-microglobulin).
Form : Lyophilized
Molecular Mass : 12.5 kDa
AA Sequence : MARSVTVIFLVLVSLAVVLAIQKTPQIQVYSRHPPENGKPNFLNCYVSQFHPPQIEIELLKNGKKIPNIEMSDLSFSKDWSFYILAHTEFTPTETDVYACRVKHVTLKEPKTVTWDRDM
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Concentration : 1 mg/mL
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name B2m beta-2 microglobulin [ Rattus norvegicus ]
Official Symbol B2M
Synonyms B2M; beta-2 microglobulin; beta-2-microglobulin;
Gene ID 24223
mRNA Refseq NM_012512
Protein Refseq NP_036644
UniProt ID P07151

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All B2M Products

Required fields are marked with *

My Review for All B2M Products

Required fields are marked with *

0

Inquiry Basket

cartIcon