Recombinant Rat B2M Protein, His and Strep-tagged

• Cat.No.: B2M-105R
• Product Overview: Recombinant Rat B2M protein with His and Strep tag was expressed in HEK293.

Specification

• Species: Rat
• Source: HEK293
• Tag: His&Strep
• Protein Length: 119
• Description: Predicted to enable MHC class II protein complex binding activity and protein homodimerization activity. Involved in response to cadmium ion and response to xenobiotic stimulus. Located in extracellular space. Biomarker of acute kidney failure; pyelonephritis; and ureteral obstruction. Human ortholog(s) of this gene implicated in arthritis; familial visceral amyloidosis; immunodeficiency 43; and inflammatory bowel disease. Orthologous to human B2M (beta-2-microglobulin).
• Form: Lyophilized
• Molecular Mass: 12.5 kDa
• AA Sequence: MARSVTVIFLVLVSLAVVLAIQKTPQIQVYSRHPPENGKPNFLNCYVSQFHPPQIEIELLKNGKKIPNIEMSDLSFSKDWSFYILAHTEFTPTETDVYACRVKHVTLKEPKTVTWDRDM
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: B2m beta-2 microglobulin [ Rattus norvegicus ]
• Official Symbol: B2M
• Synonyms: B2M; beta-2 microglobulin; beta-2-microglobulin
• Gene ID: 24223
• mRNA Refseq: NM_012512
• Protein Refseq: NP_036644
• UniProt ID: P07151