Recombinant Rat B2M Protein, His and Strep-tagged

Description :	Predicted to enable MHC class II protein complex binding activity and protein homodimerization activity. Involved in response to cadmium ion and response to xenobiotic stimulus. Located in extracellular space. Biomarker of acute kidney failure; pyelonephritis; and ureteral obstruction. Human ortholog(s) of this gene implicated in arthritis; familial visceral amyloidosis; immunodeficiency 43; and inflammatory bowel disease. Orthologous to human B2M (beta-2-microglobulin).
Source :	HEK293
Species :	Rat
Tag :	His&Strep
Form :	Lyophilized
Molecular Mass :	12.5 kDa
Protein length :	119
AA Sequence :	MARSVTVIFLVLVSLAVVLAIQKTPQIQVYSRHPPENGKPNFLNCYVSQFHPPQIEIELLKNGKKIPNIEMSDLSFSKDWSFYILAHTEFTPTETDVYACRVKHVTLKEPKTVTWDRDM
Purity :	> 98%
Applications :	WB; ELISA; FACS; FC
Stability :	This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage :	At -20 centigrade.
Concentration :	1 mg/mL
Storage Buffer :	PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution :	Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Name	B2m beta-2 microglobulin [ Rattus norvegicus ]
Official Symbol	B2M
Synonyms	B2M; beta-2 microglobulin; beta-2-microglobulin;
Gene ID	24223
mRNA Refseq	NM_012512
Protein Refseq	NP_036644
UniProt ID	P07151

ACE2-735H	Recombinant Human ACE2 Protein, His-tagged	+Inquiry
FGF10-15H	Active Recombinant Human FGF10 protein	+Inquiry
KITLG-19H	Active Recombinant Human KITLG Protein, Pre-aliquoted	+Inquiry
DEFB1-17H	Active Recombinant Human DEFB1 protein(1-47aa)	+Inquiry
DEFB4-18H	Active Recombinant Human DEFB4 protein(1-50aa)	+Inquiry