Recombinant Full Length Human B2M Protein, C-Flag-tagged
Cat.No. : | B2M-1240HFL |
Product Overview : | Recombinant Full Length Human B2M Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a serum protein found in association with the major histocompatibility complex (MHC) class I heavy chain on the surface of nearly all nucleated cells. The protein has a predominantly beta-pleated sheet structure that can form amyloid fibrils in some pathological conditions. The encoded antimicrobial protein displays antibacterial activity in amniotic fluid. A mutation in this gene has been shown to result in hypercatabolic hypoproteinemia. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 11.7 kDa |
AA Sequence : | MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Protein Pathways : | Antigen processing and presentation |
Full Length : | Full L. |
Gene Name | B2M beta-2-microglobulin [ Homo sapiens (human) |
Official Symbol | B2M |
Synonyms | IMD43 |
Gene ID | 567 |
mRNA Refseq | NM_004048.4 |
Protein Refseq | NP_004039.1 |
MIM | 109700 |
UniProt ID | P61769 |
◆ Recombinant Proteins | ||
B2M-1240HFL | Recombinant Full Length Human B2M Protein, C-Flag-tagged | +Inquiry |
B2M-0235H | Recombinant Human B2M Protein (Met1-Met119), Tag Free | +Inquiry |
B2M-26790TH | Recombinant Human B2M | +Inquiry |
B2M-2101C | Recombinant Cynomolgus B2M protein, His-tagged | +Inquiry |
B2M-6744H | Recombinant Human B2M protein, hFc-tagged | +Inquiry |
◆ Native Proteins | ||
B2M-8046H | Native Human Beta 2 MicroGlobulin | +Inquiry |
B2M-5366H | Native Human Beta-2-Microglobulin | +Inquiry |
B2M-13H | Native Human B2M | +Inquiry |
◆ Cell & Tissue Lysates | ||
B2M-1656MCL | Recombinant Mouse B2M cell lysate | +Inquiry |
B2M-1550RCL | Recombinant Rat B2M cell lysate | +Inquiry |
B2M-2204HCL | Recombinant Human B2M cell lysate | +Inquiry |
B2M-1512CCL | Recombinant Cynomolgus B2M cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All B2M Products
Required fields are marked with *
My Review for All B2M Products
Required fields are marked with *
0
Inquiry Basket