Recombinant Rabbit APOE Protein, His/MYC-tagged
Cat.No. : | APOE-1127R |
Product Overview : | Recombinant Rabbit APOE Protein (20-311aa) was expressed in E. coli with N-terminal 10xHis-SUMO-tag and C-terminal Myc-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rabbit |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 20-311 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 38.6 kDa |
AA Sequence : | TEQEVEVPEQARWKAGQPWELALGRFWDYLRWVQSLSDQVQEELLSSQVTQELTMLMEETMKEVKAYKSELEEQLSPMAQEHRARLSKELQVAGALEADMEDVCNRLAQYRGEAQAMLGQSTEELARAFSSHLRKLRKRLLRDAEDLQKRMAVYGAGAREGAERGVSAVRERLGSRLERGRLRVATVGTLAGRPLRERAQAWGERLRGHLEEVGSRARDRLNEVREQVEEVRVKVEEQAPQMRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKLQAAMPSKAPAAAPIENQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | APOE apolipoprotein E [ Oryctolagus cuniculus (rabbit) ] |
Official Symbol | APOE |
Synonyms | APOE; apolipoprotein E; apo-E |
Gene ID | 100009337 |
mRNA Refseq | NM_001082643.1 |
Protein Refseq | NP_001076112.1 |
UniProt ID | P18287 |
◆ Recombinant Proteins | ||
Apoe-5608M | Recombinant Mouse Apoe protein, His-tagged | +Inquiry |
APOE-56H | Recombinant Human APOE Protein, His-tagged | +Inquiry |
Apoe-25M | Recombinant Mouse Apoe protein, His-tagged | +Inquiry |
Apoe-687M | Recombinant Mouse Apoe protein, His & GST-tagged | +Inquiry |
APOE-726R | Recombinant Full Length Rat apolipoprotein E Protein, His tagged | +Inquiry |
◆ Native Proteins | ||
APOE-5336H | Native Human Apolipoprotein E | +Inquiry |
ApoE-3560H | Native Human ApoE | +Inquiry |
APOE-5283H | Native Human Apolipoprotein E | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOE-8780HCL | Recombinant Human APOE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All APOE Products
Required fields are marked with *
My Review for All APOE Products
Required fields are marked with *
0
Inquiry Basket