Recombinant Puccinia triticina (isolate 1-1 / race 1 (BBBD)) PTTG protein(32-121aa), His-tagged

• Cat.No.: PTTG-652P
• Product Overview: Recombinant Puccinia triticina (isolate 1-1 / race 1 (BBBD)) PTTG protein(A0A180H5P9)(32-121aa), fused with C-terminal His tag, was expressed in Yeast.

Specification

• Species: Puccinia triticina
• Source: Yeast
• Tag: His
• ProteinLength: 32-121aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 11.4 kDa
• AASequence: IEVIQCGKCNLSVTGESSTMPCPKLKKCGIHTCGNMNRSATAWRCTCGWYKSKPTGTCNQCGAECACKVSTDSYTKKLSRQASSSHWDWE
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.