Recombinant Human CSNK2B Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CSNK2B-731H
• Product Overview: CSNK2B MS Standard C13 and N15-labeled recombinant protein (NP_001311) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes the beta subunit of casein kinase II, a ubiquitous protein kinase which regulates metabolic pathways, signal transduction, transcription, translation, and replication. The enzyme is composed of three subunits, alpha, alpha prime and beta, which form a tetrameric holoenzyme. The alpha and alpha prime subunits are catalytic, while the beta subunit serves regulatory functions. The enzyme localizes to the endoplasmic reticulum and the Golgi apparatus. Two transcript variants encoding different isoforms have been found for this gene.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 24.9 kDa
• AA Sequence: MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CSNK2B casein kinase 2 beta [ Homo sapiens (human) ]
• Official Symbol: CSNK2B
• Synonyms: CSNK2B; casein kinase 2, beta polypeptide; casein kinase II subunit beta; phosvitin; CK II beta; protein G5a; Casein kinase II beta subunit; alternative name: G5a, phosvitin; G5A; CK2B; CK2N; CSK2B; MGC138222; MGC138224
• Gene ID: 1460
• mRNA Refseq: NM_001320
• Protein Refseq: NP_001311
• MIM: 115441
• UniProt ID: P67870