Recombinant Full Length Salmonella Typhimurium Cell Invasion Protein Sipb(Sipb) Protein, His-Tagged
Cat.No. : | RFL20197SF |
Product Overview : | Recombinant Full Length Salmonella typhimurium Cell invasion protein sipB(sipB) Protein (Q56019) (1-593aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella typhimurium |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-593) |
Form : | Lyophilized powder |
AA Sequence : | MVNDASSISRSGYTQNPRLAEAAFEGVRKNTDFLKAADKAFKDVVATKAGDLKAGTKSGE SAINTVGLKPPTDAAREKLSSEGQLTLLLGKLMTLLGDVSLSQLESRLAVWQAMIESQKE MGIQVSKEFQTALGEAQEATDLYEASIKKTDTAKSVYDAATKKLTQAQNKLQSLDPADPG YAQAEAAVEQAGKEATEAKEALDKATDATVKAGTDAKAKAEKADNILTKFQGTANAASQN QVSQGEQDNLSNVARLTMLMAMFIEIVGKNTEESLQNDLALFNALQEGRQAEMEKKSAEF QEETRKAEETNRIMGCIGKVLGALLTIVSVVAAVFTGGASLALAAVGLAVMVADEIVKAA TGVSFIQQALNPIMEHVLKPLMELIGKAITKALEGLGVDKKTAEMAGSIVGAIVAAIAMV AVIVVVAVVGKGAAAKLGNALSKMMGETIKKLVPNVLKQLAQNGSKLFTQGMQRITSGLG NVGSKMGLQTNALSKELVGNTLNKVALGMEVTNTAAQSAGGVAEGVFIKNASEALADFML ARFAMDQIQQWLKQSVEIFGENQKVTAELQKAMSSAVQQNADASRFILRQSRA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | sipB |
Synonyms | sipB; sspB; STM2885; Cell invasion protein SipB; Effector protein SipB |
UniProt ID | Q56019 |
◆ Recombinant Proteins | ||
RFL11199PF | Recombinant Full Length Pongo Abelii Bladder Cancer-Associated Protein(Blcap) Protein, His-Tagged | +Inquiry |
CTNNA1-399H | Recombinant Human CTNNA1 Protein, His-tagged | +Inquiry |
AFM-410H | Recombinant Human AFM Protein, GST-tagged | +Inquiry |
FCER2-539H | Recombinant Human FCER2 Protein | +Inquiry |
SLC1A2-568H | Active Recombinant Human SLC1A2 protein, His-Flag-tagged(Detergent) | +Inquiry |
◆ Native Proteins | ||
ApoB-3556H | Native Human ApoB | +Inquiry |
Complement C4a-52H | Native Human Complement C4a | +Inquiry |
Complement C4-50H | Native Human Complement C4 | +Inquiry |
Papain-149 | Active Native Immobilized Papain | +Inquiry |
GAPDH-62H | Native Human Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH) | +Inquiry |
◆ Cell & Tissue Lysates | ||
MARK2-1060HCL | Recombinant Human MARK2 cell lysate | +Inquiry |
SPANXB2-620HCL | Recombinant Human SPANXB2 lysate | +Inquiry |
MBNL1-AS1-4684HCL | Recombinant Human LOC401093 293 Cell Lysate | +Inquiry |
ARHGAP31-8738HCL | Recombinant Human ARHGAP31 293 Cell Lysate | +Inquiry |
PSMD7-2745HCL | Recombinant Human PSMD7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All sipB Products
Required fields are marked with *
My Review for All sipB Products
Required fields are marked with *
0
Inquiry Basket