Recombinant Pseudomonas syringae pv. Tomato dsbA protein, His-tagged
Cat.No. : | dsbA-4348P |
Product Overview : | Recombinant Pseudomonas syringae pv. Tomato dsbA protein(O52376)(23-214aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudomonas syringae pv. Tomato |
Source : | E.coli |
Tag : | His |
Protein Length : | 23-214aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 25.1 kDa |
AA Sequence : | AEPIESGKQYVELTSAVPVAVPGKIEVIELFWYGCPHCYAFEPTINPWVEKLPSDVNFVRIPAMFGGPWDAHGQLFITLDTMGVEHKVHAAVFEAIQKGGKRLTDKNDMADFVATQGVNKDDFLKTFDSFAVKGKIAQYKELAKKYEVTGVPTMIVNGKYRFDLGSAGGPEKTLQVADQLIDKERAAAKAAK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
DSBA-2693E | Recombinant Enterobacteria Phage T4 DSBA Protein (1-89 aa), His-Myc-tagged | +Inquiry |
dsbA-4348P | Recombinant Pseudomonas syringae pv. Tomato dsbA protein, His-tagged | +Inquiry |
DsbA-80E | Recombinant E.coli Disulfide Oxidoreductase A | +Inquiry |
◆ Native Proteins | ||
dsbA-8328E | Native E.coli dsbA | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All dsbA Products
Required fields are marked with *
My Review for All dsbA Products
Required fields are marked with *
0
Inquiry Basket