Recombinant Enterobacteria Phage T4 DSBA Protein (1-89 aa), His-Myc-tagged

• Cat.No.: DSBA-2693E
• Product Overview: Recombinant Enterobacteria Phage T4 (Bacteriophage T4) DSBA Protein (1-89 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Cell Biology. Protein Description: Full Length.

Specification

• Species: Enterobacteria Phage T4
• Source: E.coli
• Tag: His&Myc
• Protein Length: 1-89 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 17.8 kDa
• AA Sequence: MAKKEMVEFDEAIHGEDLAKFIKEASDHKLKISGYNELIKDIRIRAKDELGVDGKMFNRLLALYHKDNRDVFEAETEEVVELYDTVFSK
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: dsbA double-stranded DNA binding protein [ Escherichia virus T4 ]
• Official Symbol: DSBA
• Synonyms: dsbA
• Gene ID: 1258620
• Protein Refseq: NP_049858
• UniProt ID: P13320