Recombinant Pig CALR Protein (18-417 aa), His-tagged
Cat.No. : | CALR-2130P |
Product Overview : | Recombinant Pig CALR Protein (18-417 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Tags & Cell Markers. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pig |
Source : | Yeast |
Tag : | His |
Protein Length : | 18-417 aa |
Description : | Calcium-binding chaperone that promotes folding, oligomeric assembly and quality control in the endoplasmic reticulum (ER) via the calreticulin/calnexin cycle. This lectin interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. Interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export (By similarity). Involved in maternal gene expression regulation. May participate in oocyte maturation via the regulation of calcium homeostasis. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 48.6 kDa |
AA Sequence : | EPTIYFKEQFLDGDGWTDRWIESKHKPDFGRFVLSSGKFYGDQEKDKGLQTSQDARFYALSARFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPDGLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAVKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDSNIYAYENFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEEKKRKEEEEVDKEDEEDKDEDEEEEDEKEEEEEEDAAAGQAKDEL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | CALR calreticulin [ Sus scrofa ] |
Official Symbol | CALR |
Synonyms | CALR; calreticulin; |
Gene ID | 100381266 |
mRNA Refseq | NM_001174133 |
Protein Refseq | NP_001167604 |
UniProt ID | P28491 |
◆ Recombinant Proteins | ||
CALR-356C | Recombinant Cynomolgus CALR Protein, His-tagged | +Inquiry |
CALR-4222H | Recombinant Human CALR protein, His&Flag-tagged | +Inquiry |
CALR-0821H | Recombinant Human CALR Protein (Glu18-Pro204), N-His tagged | +Inquiry |
CALR-2288H | Recombinant Human CALR Protein, MYC/DDK-tagged | +Inquiry |
Calr-1185M | Recombinant Mouse Calreticulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
CALR-1222HCL | Recombinant Human CALR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CALR Products
Required fields are marked with *
My Review for All CALR Products
Required fields are marked with *
0
Inquiry Basket