Recombinant Pan paniscus APOB Protein

• Cat.No.: APOB-03P
• Product Overview: Recombinant Pan paniscus APOB Protein was expressed in E. coli.

Specification

• Description: Apolipoprotein B
• Source: E. coli
• Species: Pan paniscus
• Form: Liquid. In 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.
• Molecular Mass: ~17.4 kDa
• AA Sequence: AEAVLKTLQELKKLTISEQNIQRANLFNKLVTELRGLSDEAVTSLLPQLIEVSSPITLQALVQCGQPQCSTHILQWLKRVHANPLLIDVVTYLVALIPEPSAQQLREIFNMARDQRSRATLYALSHAVNNYHKTNPTGTQELLDIANYLMEQIQ
• Purity: >90%
• Storage: Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles.
• Concentration: 0.3 mg/ml
• Official Full Name: Apolipoprotein B

Gene Information

• Gene Name: APOB apolipoprotein B [ Pan paniscus (pygmy chimpanzee) ]
• Official Symbol: APOB
• Synonyms: FLDB; FCHL2; LDLCQ4; apoB-48; apoB-100
• Gene ID: 100988651
• mRNA Refseq: XM_034952688
• Protein Refseq: XP_034808579
• UniProt ID: A0A2R8ZD43