Recombinant Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) mpt64 protein, His-tagged

• Cat.No.: mpt64-2291M
• Product Overview: Recombinant Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) mpt64 protein(P9WIN9)(24-228aa), fused to N-terminal His tag, was expressed in Insect Cell.

Specification

• Species: Mycobacterium Tuberculosis
• Source: Insect Cells
• Tag: His
• ProteinLength: 24-228aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 24.9 kDa
• AA Sequence: APKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.