Recombinant Mycobacterium Tuberculosis MPT64 Protein (24-228 aa), His-MBP-tagged

• Cat.No.: MPT64-2804M
• Product Overview: Recombinant Mycobacterium Tuberculosis (strain CDC 1551/Oshkosh) MPT64 Protein (24-228 aa) is produced by Baculovirus expression system. This protein is fused with a MBP tag at the N-terminal and a 6xHis tag at the C-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Mycobacterium Tuberculosis
• Source: Insect Cells
• Tag: His&Myc
• Protein Length: 24-228 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 66.4 kDa
• AA Sequence: APKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Synonyms: mpt64
• UniProt ID: P9WIN8