Recombinant Mycobacterium Tuberculosis MPT64 Protein (24-228 aa), His-MBP-tagged
Cat.No. : | MPT64-2804M |
Product Overview : | Recombinant Mycobacterium Tuberculosis (strain CDC 1551/Oshkosh) MPT64 Protein (24-228 aa) is produced by Baculovirus expression system. This protein is fused with a MBP tag at the N-terminal and a 6xHis tag at the C-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycobacterium Tuberculosis |
Source : | Insect Cells |
Tag : | His&Myc |
Protein Length : | 24-228 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 66.4 kDa |
AA Sequence : | APKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Synonyms | mpt64; |
UniProt ID | P9WIN8 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MPT64 Products
Required fields are marked with *
My Review for All MPT64 Products
Required fields are marked with *
0
Inquiry Basket