Recombinant Mycobacterium Tuberculosis CFP2 Protein (49-168 aa), His-tagged

• Cat.No.: CFP2-1626M
• Product Overview: Recombinant Mycobacterium Tuberculosis (strain CDC 1551/Oshkosh) CFP2 Protein (49-168 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Mycobacterium Tuberculosis
• Source: Yeast
• Tag: His
• Protein Length: 49-168 aa
• Description: May play a role in the development of protective immune responses.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 14.1 kDa
• AA Sequence: DPASAPDVPTAAQLTSLLNSLADPNVSFANKGSLVEGGIGGTEARIADHKLKKAAEHGDLPLSFSVTNIQPAAAGSATADVSVSGPKLSSPVTQNVTFVNQGGWMLSRASAMELLQAAGN
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: cfp2 low molecular weight antigen MTB12 [ Mycobacterium tuberculosis H37Rv ]
• Official Symbol: CFP2
• Synonyms: mtb12
• Gene ID: 885515
• UniProt ID: P9WIN6