Recombinant Mouse YWHAB Protein (1-246 aa), His-tagged
Cat.No. : | YWHAB-2401M |
Product Overview : | Recombinant Mouse YWHAB Protein (1-246 aa) is produced by Yeast expression system. This protein is fused with a 10xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-246 aa |
Description : | Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negative regulator of osteogenesis. Blocks the nuclear translocation of the phosphorylated form (by AKT1) of SRPK2 and antagonizes its stimulatory effect on cyclin D1 expression resulting in blockage of neuronal apoptosis elicited by SRPK2. Negative regulator of signaling cascades that mediate activation of MAP kinases via AKAP13. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 30.6 kDa |
AA Sequence : | MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLILNATQAESKVFYLKMKGDYFRYLSEVASGENKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Ywhab tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide [ Mus musculus ] |
Official Symbol | YWHAB |
Synonyms | YWHAB; 14-3-3 protein beta/alpha; KCIP-1; 14-3-3 protein beta; protein kinase C inhibitor protein 1; 1300003C17Rik; |
Gene ID | 54401 |
mRNA Refseq | NM_018753 |
Protein Refseq | NP_061223 |
UniProt ID | Q9CQV8 |
◆ Recombinant Proteins | ||
YWHAB-4211H | Recombinant Human YWHAB protein, His-tagged | +Inquiry |
YWHAB-6637R | Recombinant Rat YWHAB Protein | +Inquiry |
YWHAB-6293R | Recombinant Rat YWHAB Protein, His (Fc)-Avi-tagged | +Inquiry |
YWHAB-2401M | Recombinant Mouse YWHAB Protein (1-246 aa), His-tagged | +Inquiry |
YWHAB-1170C | Recombinant Cynomolgus YWHAB protein(Met2-Asn244) | +Inquiry |
◆ Cell & Tissue Lysates | ||
YWHAB-234HCL | Recombinant Human YWHAB 293 Cell Lysate | +Inquiry |
YWHAB-233HCL | Recombinant Human YWHAB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All YWHAB Products
Required fields are marked with *
My Review for All YWHAB Products
Required fields are marked with *
0
Inquiry Basket