Recombinant Mouse WISP2 Protein (24-251 aa), His-SUMO-tagged

• Cat.No.: WISP2-1166M
• Product Overview: Recombinant Mouse WISP2 Protein (24-251 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 24-251 aa
• Description: May play an important role in modulating bone turnover. Promotes the adhesion of osteoblast cells and inhibits the binding of fibrinogen to integrin receptors. In addition, inhibits osteocalcin production.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 40.5 kDa
• AA Sequence: QLCPAPCACPWTPPQCPPGVPLVLDGCGCCRVCARRLGESCDHLHVCDPSQGLVCQPGAGPSGRGAVCLFEEDDGSCEVNGRRYLDGETFKPNCRVLCRCDDGGFTCLPLCSEDVRLPSWDCPRPRRIQVPGRCCPEWVCDQAVMQPAIQPSSAQGHQLSALVTPASADGPCPNWSTAWGPCSTTCGLGIATRVSNQNRFCQLEIQRRLCLSRPCLASRSHGSWNSAF
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Wisp2 WNT1 inducible signaling pathway protein 2 [ Mus musculus ]
• Official Symbol: WISP2
• Synonyms: WISP2; CTGF-L; WISP-2; Ccn5; Crgr4; Ctgfl; Rcop1
• Gene ID: 22403
• mRNA Refseq: NM_016873
• Protein Refseq: NP_058569
• UniProt ID: Q9Z0G4