Recombinant Mouse WISP2 Protein (24-251 aa), His-tagged

• Cat.No.: WISP2-1754M
• Product Overview: Recombinant Mouse WISP2 Protein (24-251 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Mouse
• Source: Yeast
• Tag: His
• Protein Length: 24-251 aa
• Description: May play an important role in modulating bone turnover. Promotes the adhesion of osteoblast cells and inhibits the binding of fibrinogen to integrin receptors. In addition, inhibits osteocalcin production (By similarity).
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 26.5 kDa
• AA Sequence: QLCPAPCACPWTPPQCPPGVPLVLDGCGCCRVCARRLGESCDHLHVCDPSQGLVCQPGAGPSGRGAVCLFEEDDGSCEVNGRRYLDGETFKPNCRVLCRCDDGGFTCLPLCSEDVRLPSWDCPRPRRIQVPGRCCPEWVCDQAVMQPAIQPSSAQGHQLSALVTPASADGPCPNWSTAWGPCSTTCGLGIATRVSNQNRFCQLEIQRRLCLSRPCLASRSHGSWNSAF
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Wisp2 WNT1 inducible signaling pathway protein 2 [ Mus musculus ]
• Official Symbol: WISP2
• Synonyms: WISP2; CTGF-L; WISP-2; CCN family member 5; Ccn5; Crgr4; Ctgfl; Rcop1
• Gene ID: 22403
• mRNA Refseq: NM_016873
• Protein Refseq: NP_058569
• UniProt ID: Q9Z0G4