Recombinant Mouse VWF Protein, His tagged

• Cat.No.: VWF-18420M
• Product Overview: Recombinant Mouse VWF Protein with His tag was expressed in HEK293.

Specification

• Species: Mouse
• Source: HEK293
• Tag: His
• Description: Predicted to enable several functions, including chaperone binding activity; identical protein binding activity; and integrin binding activity. Acts upstream of or within several processes, including liver development; placenta development; and platelet activation. Located in external side of plasma membrane. Is expressed in several structures, including cardiovascular system; extraembryonic component; genitourinary system; leptomeninges; and vitelline blood vessel. Used to study von Willebrand's disease and von Willebrand's disease 2. Human ortholog(s) of this gene implicated in several diseases, including Behcet's disease; Bernard-Soulier syndrome; end stage renal disease; essential thrombocythemia; and von Willebrand's disease (multiple). Orthologous to human VWF (von Willebrand factor).
• Molecular Mass: The protein has a calculated MW of 55 kDa.
• AA Sequence: HHHHHHSLSCRPPMVKLVCPADNPRAQGLECAKTCQNYDLERMSLGCVSGCLCPPGMVRHENKCVALERCPCFHQGAEYAPGDTVKIGCNTCVCRERKWNCTNHVCDATRSAIGMAHYLTFDGLKYLFPGECQYVLVYDYCGSNPGTFQILVGNEGCSYPSVKCRKRVTILVDGGELELFDGEVNVKRPLRDESHFEVVESGRYVILLLGQALSVVWDHHLSISVVLKHTYQEQVCGLCGNFDGIQNNDSTTSSLQVEEDPVNFGNSWKVSSQCADTRKLSLDVSPATCHNNIMKQTMVDSACRILTSDVFQGCNRLVDPEPYLDICIYDTCSCESIGDCACFCDTIAAYAHVCAQHGQVVAWRTPTLCPQSCEEKNVRENGYECEWRYNSCAPACPVTCQHPEPLACPVQCVEGCHAHCPPGRILDELLQTCVDPQDCPVCEVAGRRLAPGKKITLSPDDPAHCQNCHCDGVNLTCEACQEPGGLVAPPTDAPVSSTTPYVEDTP
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.018 mg/mL by BCA
• Storage Buffer: Sterile PB, 500 mM NaCl, pH 7.4

Gene Information

• Gene Name: Vwf Von Willebrand factor homolog [ Mus musculus (house mouse) ]
• Official Symbol: Vwf
• Synonyms: VWF; Von Willebrand factor homolog; von Willebrand factor; VWD; F8VWF; AI551257; C630030D09; 6820430P06Rik; B130011O06Rik
• Gene ID: 22371
• mRNA Refseq: NM_011708
• Protein Refseq: NP_035838
• UniProt ID: Q8CIZ8