Recombinant Mouse Vcan protein, His&Myc-tagged

• Cat.No.: Vcan-4519M
• Product Overview: Recombinant Mouse Vcan protein(Q62059)(24-146aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&Myc
• Protein Length: 24-146aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 20.9 kDa
• AA Sequence: AKMETSPPVKGSLSGKVVLPCHFSTLPTLPPNYNTSEFLRIKWSKMEVDKNGKDIKETTVLVAQNGNIKIGQDYKGRVSVPTHPDDVGDASLTMVKLRASDAAVYRCDVMYGIEDTQDTMSLA
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Vcan versican [ Mus musculus ]
• Official Symbol: Vcan
• Synonyms: VCAN; versican; versican core protein; heart defect; PG-M core protein; large fibroblast proteoglycan; chondroitin sulfate proteoglycan 2; chondroitin sulfate proteoglycan core protein 2; Versican core protein precursor (Large fibroblast proteoglycan) (Chondroitin sulfate proteoglycan core protein 2) (PG-M); NG2; hdf; PG-M; Cspg2; DPEAAE; PG-M(V0); PG-M(V1); 9430051N09; 5430420N07Rik
• Gene ID: 13003
• mRNA Refseq: NM_001081249
• Protein Refseq: NP_001074718