Recombinant Human VCAN protein, His-B2M & Myc-tagged

• Cat.No.: VCAN-3651H
• Product Overview: Recombinant Human VCAN protein(P13611)(3089-3354aa), fused to N-terminal His-B2M tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His&Myc&B2M
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 47.6 kDa
• Protein length: 3089-3354aa
• AA Sequence: GPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMN
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: VCAN versican [ Homo sapiens ]
• Official Symbol: VCAN
• Synonyms: VCAN; versican; chondroitin sulfate proteoglycan 2 , CSPG2; versican core protein; PG M; versican proteoglycan; large fibroblast proteoglycan; glial hyaluronate-binding protein; chondroitin sulfate proteoglycan 2; chondroitin sulfate proteoglycan core protein 2; WGN; ERVR; GHAP; PG-M; WGN1; CSPG2; DKFZp686K06110
• Gene ID: 1462
• mRNA Refseq: NM_001126336
• Protein Refseq: NP_001119808
• MIM: 118661
• UniProt ID: P13611