Recombinant Human VCAN protein, His-B2M & Myc-tagged
Cat.No. : | VCAN-3651H |
Product Overview : | Recombinant Human VCAN protein(P13611)(3089-3354aa), fused to N-terminal His-B2M tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | B2M&His&Myc |
Protein Length : | 3089-3354aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 47.6 kDa |
AA Sequence : | GPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMN |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | VCAN versican [ Homo sapiens ] |
Official Symbol | VCAN |
Synonyms | VCAN; versican; chondroitin sulfate proteoglycan 2 , CSPG2; versican core protein; PG M; versican proteoglycan; large fibroblast proteoglycan; glial hyaluronate-binding protein; chondroitin sulfate proteoglycan 2; chondroitin sulfate proteoglycan core protein 2; WGN; ERVR; GHAP; PG-M; WGN1; CSPG2; DKFZp686K06110; |
Gene ID | 1462 |
mRNA Refseq | NM_001126336 |
Protein Refseq | NP_001119808 |
MIM | 118661 |
UniProt ID | P13611 |
◆ Recombinant Proteins | ||
Vcan-4519M | Recombinant Mouse Vcan protein, His&Myc-tagged | +Inquiry |
VCAN-3651H | Recombinant Human VCAN protein, His-B2M & Myc-tagged | +Inquiry |
VCAN-552H | Recombinant Human VCAN Protein, His-tagged | +Inquiry |
VCAN-48H | Recombinant Human VCAN protein, GST-tagged | +Inquiry |
VCAN-211H | Recombinant Human VCAN protein, T7/His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VCAN-413HCL | Recombinant Human VCAN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VCAN Products
Required fields are marked with *
My Review for All VCAN Products
Required fields are marked with *
0
Inquiry Basket