Recombinant Human VCAN Protein (3089-3354 aa), His-Myc-tagged

• Cat.No.: VCAN-2811H
• Product Overview: Recombinant Human VCAN Protein (3089-3354 aa) is produced by Baculovirus expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Signal Transduction. Protein Description: Partial.

Specification

• Species: Human
• Source: Insect Cells
• Tag: His&Myc
• Protein Length: 3089-3354 aa
• Description: May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 34.6 kDa
• AA Sequence: GPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMN
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: VCAN versican [ Homo sapiens ]
• Official Symbol: VCAN
• Synonyms: VCAN; versican; versican core protein; PG M; versican proteoglycan; WGN; ERVR; GHAP; PG-M; WGN1; CSPG2; DKFZp686K06110
• Gene ID: 1462
• mRNA Refseq: NM_001126336
• Protein Refseq: NP_001119808
• MIM: 118661
• UniProt ID: P13611