Recombinant Human VCAN Protein (3089-3354 aa), His-Myc-tagged

Cat.No. : VCAN-2811H
Product Overview : Recombinant Human VCAN Protein (3089-3354 aa) is produced by Baculovirus expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Signal Transduction. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His&Myc
Protein Length : 3089-3354 aa
Description : May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 34.6 kDa
AA Sequence : GPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMN
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name VCAN versican [ Homo sapiens ]
Official Symbol VCAN
Synonyms VCAN; versican; versican core protein; PG M; versican proteoglycan; WGN; ERVR; GHAP; PG-M; WGN1; CSPG2; DKFZp686K06110;
Gene ID 1462
mRNA Refseq NM_001126336
Protein Refseq NP_001119808
MIM 118661
UniProt ID P13611

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All VCAN Products

Required fields are marked with *

My Review for All VCAN Products

Required fields are marked with *

0

Inquiry Basket

cartIcon