Recombinant Mouse Twist1 protein, His-KSI-tagged

• Cat.No.: Twist1-6250M
• Product Overview: Recombinant Mouse Twist1 protein(P26687)(1-206aa), fused with N-terminal His and KSI tag, was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: N-His-KSI
• ProteinLength: 1-206aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 36.5 kDa
• AASequence: MMQDVSSSPVSPADDSLSNSEEEPDRQQPASGKRGARKRRSSRRSAGGSAGPGGATGGGIGGGDEPGSPAQGKRGKKSAGGGGGGGAGGGGGGGGGSSSGGGSPQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Twist1 twist homolog 1 (Drosophila) [ Mus musculus ]
• Official Symbol: Twist1
• Synonyms: TWIST1; twist homolog 1 (Drosophila); twist-related protein 1; Pluridigite; charlie chaplin; polydactyly EMS; Ska< sup> m10Jus< /sup> twist gene homolog 1; Pde; pdt; Ska10; Twist; M-Twist; bHLHa38; AA960487; m10Jus> MGC103391
• Gene ID: 22160
• mRNA Refseq: NM_011658
• Protein Refseq: NP_035788