Recombinant Mouse Tslp Protein, His-tagged

• Cat.No.: Tslp-01M
• Product Overview: Recombinant Mouse TSLP (20-140 aa, 130aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using
  conventional chromatography techniques.

Specification

• Description: Cytokine that induces the release of T-cell-attracting chemokines from monocytes and, in particular, enhances the maturation of CD11c+ dendritic cells. Can induce allergic inflammation by directly activating mast cells.
• Source: Insect cell
• Species: Mouse
• Tag: His
• Form: Liquid
• Molecular Mass: 15 kDa
• Protein length: 20-140
• AA Sequence: YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPE
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 90% by SDS-PAGE
• Applications: SDS-PAGE
• Storage: Can be stored at 2 to 8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.5 mg/mL (determined by absorbance at 280nm)
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol

Gene Information

• Gene Name: Tslp thymic stromal lymphopoietin [ Mus musculus (house mouse) ]
• Official Symbol: Tslp
• Synonyms: Tslp; thymic stromal lymphopoietin; thymic stromal lymphopoietin; thymic stroma-derived lymphopoietin
• Gene ID: 53603
• mRNA Refseq: NM_021367
• Protein Refseq: NP_067342
• UniProt ID: Q9JIE6