Recombinant Mouse Trim21 protein, His-SUMO-tagged

• Cat.No.: Trim21-4539M
• Product Overview: Recombinant Mouse Trim21 protein(Q62191)(1-470aa), fused to N-terminal His-SUMO tag, was expressed in E. coli

Specification

• Source: E. coli
• Species: Mouse
• Tag: His&SUMO
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 70.2 kDa
• Protein length: 1-470aa
• AA Sequence: MSPSTTSKMSLEKMWEEVTCSICLDPMVEPMSIECGHCFCKECIFEVGKNGGSSCPECRQQFLLRNLRPNRHIANMVENLKQIAQNTKKSTQETHCMKHGEKLHLFCEEDGQALCWVCAQSGKHRDHTRVPIEEAAKVYQEKIHVVLEKLRKGKELAEKMEMDLTMQRTDWKRNIDTQKSRIHAEFALQNSLLAQEEQRQLQRLEKDQREYLRLLGKKEAELAEKNQALQELISELERRIRGSELELLQEVRIILERSGSWNLDTLDIDAPDLTSTCPVPGRKKMLRTCWVHITLDRNTANSWLIISKDRRQVRMGDTHQNVSDNKERFSNYPMVLGAQRFSSGKMYWEVDVTQKEAWDLGVCRDSVQRKGQFSLSPENGFWTIWLWQDSYEAGTSPQTTLHIQVPPCQIGIFVDYEAGVVSFYNITDHGSLIYTFSECVFAGPLRPFFNVGFNYSGGNAAPLKLCPLKM
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Trim21 tripartite motif-containing 21 [ Mus musculus ]
• Official Symbol: Trim21
• Synonyms: TRIM21; tripartite motif-containing 21; E3 ubiquitin-protein ligase TRIM21; SS-A; ro(SS-A); 52 kDa Ro protein; 52kD Ro/SSA autoantigen; Sjogren syndrome antigen A1; tripartite motif protein 21; sjoegren syndrome type A antigen; tripartite motif-containing protein 21; 52 kDa ribonucleoprotein autoantigen Ro/SS-A; Ro52; Ssa1
• Gene ID: 20821
• mRNA Refseq: NM_001082552
• Protein Refseq: NP_001076021