Recombinant Mouse Trem1 protein, His-tagged

• Cat.No.: Trem1-17319M
• Product Overview: Recombinant Mouse Trem1(Ala21-Ser202) fused with 10-his tag at C-terminal was expressed in HEK293.

Specification

• Species: Mouse
• Source: HEK293
• Tag: His
• Protein Length: Ala21-Ser202
• Description: Triggering Receptor Expressed on Myeloid Cells 1 (TREM-1) is a transmembrane protein with a single Ig-like domain. TREM-1 associates with the adapter protein, DAP12, to deliver an activating signal. TREM-1 is expressed on blood neutrophils and monocytes, and the expression is up-regulated by bacterial LPS. TREM-1 is expressed at high levels on neutrophils of patients with microbial sepsis and in mice with a TREM-1/Fc fusion protein protected mice against LPS-induced shock. It stimulates neutrophil and monocyte-mediated inflammatory responses. Triggers release of pro-inflammatory chemokines and cytokines, as well as increased surface expression of cell activation markers. TREM-1 is amplifier of inflammatory responses that are triggered by bacterial and fungal infections and are a crucial mediator of septic shock.
• Form: Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
• AA Sequence: AIVLEEERYDLVEGQTLTVKCPFNIMKYANSQKAWQRLPDGKEPLTLVVTQRPFTRPSEVHMGKF TLKHDPSEAMLQVQMTDLQVTDSGLYRCVIYHPPNDPVVLFHPVRLVVTKGSSDVFTPVIIPITR LTERPILITTKYSPSDTTTTRSLPKPTAVVSSPGLGVTIINGTDADSVSTSSHHHHHH
• Endotoxin: Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.
  Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.
  Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
  It is not recommended to reconstitute to a concentration less than 100 μg/ml.
  Dissolve the lyophilized protein in ddH2O.
  Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• Shipping: The product is shipped at ambient temperature.

Gene Information

• Gene Name: Trem1 triggering receptor expressed on myeloid cells 1 [ Mus musculus ]
• Official Symbol: Trem1
• Synonyms: TREM1; triggering receptor expressed on myeloid cells 1; triggering receptor expressed in monocytes 1
• Gene ID: 58217
• mRNA Refseq: NM_021406
• Protein Refseq: NP_067381
• UniProt ID: Q9JKE2
• Chromosome Location: 17; 17 C
• Pathway: Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem
• Function: receptor activity