Recombinant Mouse Tnfrsf13c Protein, Fc-tagged

• Cat.No.: Tnfrsf13c-099M
• Product Overview: Recombinant Mouse Tnfrsf13c protein with Fc tag was expressed in HEK293.

Specification

• Species: Mouse
• Source: HEK293
• Tag: Fc
• Protein Length: 175
• Description: Predicted to enable signaling receptor activity. Acts upstream of or within several processes, including positive regulation of germinal center formation; positive regulation of interferon-gamma production; and positive regulation of lymphocyte activation. Located in external side of plasma membrane. Is expressed in genitourinary system; hemolymphoid system gland; lung; and retina. Human ortholog(s) of this gene implicated in common variable immunodeficiency. Orthologous to human TNFRSF13C (TNF receptor superfamily member 13C).
• Form: Lyophilized
• Molecular Mass: 33.3 kDa
• AA Sequence: MGARRLRVRSQRSRDSSVPTQCNQTECFDPLVRNCVSCELFHTPDTGHTSSLEPGTALQPQEGSALRPDVALLVGAPALLGLILALTLVGLVSLVSWRWRQQLRTASPDTSEGVQQESLENVFVPSSETPHASAPTWPPLKEDADSALPRHSVPVPATELGSTELVTTKTAGPEQ
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: Tnfrsf13c tumor necrosis factor receptor superfamily, member 13c [ Mus musculus (house mouse) ]
• Official Symbol: Tnfrsf13c
• Synonyms: TNFRSF13C; tumor necrosis factor receptor superfamily, member 13c; tumor necrosis factor receptor superfamily member 13C; BAFF receptor; BLyS receptor 3; B-cell maturation defect 1; B-cell-activating factor receptor; b cell-activating factor receptor; Bcmd; Baffr; Bcmd1; BAFF-R; Bcmd-1; Lvis22; 2010006P15Rik; MGC123890; MGC123891
• Gene ID: 72049
• mRNA Refseq: NM_028075
• Protein Refseq: NP_082351
• UniProt ID: Q9D8D0