Recombinant Human TNFRSF13C protein

• Cat.No.: TNFRSF13C-39H
• Product Overview: Recombinant Human TNFRSF13C protein was expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 76
• Description: B Cell Activating Factor Receptor (BAFF-R), also named tumor necrosis factor receptor superfamily member 13C, is a member of the TNFR superfamily. It is highly expressed in spleen, lymph node, and resting B cells and to some extent in activated B cells, resting CD4+ cells and peripheral blood leukocytes. BAFF receptor is a type III transmembrane protein containing a single extracellular phenylalanine-rich domain and binds with high specificity to BAFF (TNFSF13B). It enhances B-cell survival in vitro and is a regulator of the peripheral B-cell population. BAFF receptor/BAFF signaling plays a critical role in B cell survival and maturation.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 8.0, 500 mM NaCl.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by its ability to block BAFF induced mouse splenocyte survival is 1.0-5.0 μg/ml in the presence of 1.0 μg/ml of rHuBAFF.
• Molecular Mass: Approximately 7.8 kDa, a single non-glycosylated polypeptide chain containing 76 amino acids.
• AA Sequence: MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPG
• Endotoxin: Less than 1 EU/μg of rHuBAFF-R as determined by LAL method.
• Purity: >95% by reduced SDS-PAGE analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: TNFRSF13C
• Official Symbol: TNFRSF13C
• Synonyms: TNFRSF13C; tumor necrosis factor receptor superfamily, member 13C; tumor necrosis factor receptor superfamily member 13C; BAFFR; CD268; BAFF receptor; BLyS receptor 3; B cell-activating factor receptor; B-cell-activating factor receptor; CVID4; BAFF-R; BROMIX; prolixin; MGC138235
• Gene ID: 115650
• mRNA Refseq: NM_052945
• Protein Refseq: NP_443177
• MIM: 606269
• UniProt ID: Q96RJ3