Active Recombinant Human TNFRSF13C Protein (1-78aa), C-hIgG-His tagged

• Cat.No.: TNFRSF13C-05H
• Product Overview: Recombinant human BAFFR (1-78aa), fused to hIgG-tag at Cterminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.

Specification

• Species: Human
• Source: HEK293
• Tag: Fc&His
• Protein Length: 1-78aa
• Description: B-cell receptor specific for TNFSF13B/TALL1/BAFF/BLyS. Promotes the survival of mature B-cells and the B-cell response.
• Form: Liquid
• Bio-activity: Measured by its binding ability in a functional ELISA with Human BAFF. The ED50 range ≤ 0.7 μg/mL.
• Molecular Mass: 34.4 kDa (314aa)
• AA Sequence: < DGS> MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPGLL< LEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK>
• Endotoxin: < 1.0 EU/μg of the protein by the LAL method.
• Purity: > 95% by SDS-PAGE
• Applications: SDS-PAGE, Bioactivity
• Notes: For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 1 mg/mL (determined by Absorbance at 280nm)
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol

Gene Information

• Gene Name: TNFRSF13C tumor necrosis factor receptor superfamily, member 13C [ Homo sapiens (human) ]
• Official Symbol: TNFRSF13C
• Synonyms: TNFRSF13C; tumor necrosis factor receptor superfamily, member 13C; tumor necrosis factor receptor superfamily member 13C; BAFFR; CD268; BAFF receptor; BLyS receptor 3; B cell-activating factor receptor; B-cell-activating factor receptor; CVID4; BAFF-R; BROMIX; prolixin; MGC138235
• Gene ID: 115650
• mRNA Refseq: NM_052945
• Protein Refseq: NP_443177
• MIM: 606269
• UniProt ID: Q96RJ3