Recombinant Mouse Tnf protein, His-SUMO-tagged

• Cat.No.: Tnf-3598M
• Product Overview: Recombinant Mouse Tnf protein(P06804)(57-235aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 57-235aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 35.7 kDa
• AA Sequence: GPQRDEKFPNGLPLISSMAQTLTLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Tnf tumor necrosis factor [ Mus musculus ]
• Official Symbol: Tnf
• Synonyms: TNF; tumor necrosis factor; TNF-a; TNF alpha; cachectin; tumor necrosis factor alpha; tumor necrosis factor-alpha; tumor necrosis factor ligand superfamily member 2; DIF; Tnfa; TNFSF2; Tnfsf1a; TNFalpha; TNF-alpha; MGC151434
• Gene ID: 21926
• mRNA Refseq: NM_013693
• Protein Refseq: NP_038721