Recombinant Mouse Tmprss2 protein, His-tagged

• Cat.No.: Tmprss2-648M
• Product Overview: Recombinant Mouse Tmprss2 protein(Q9JIQ8)(105-490aa), fused with N-terminal His tag, was expressed in Yeast.

Specification

• Species: Mouse
• Source: Yeast
• Tag: His
• ProteinLength: 105-490aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 44.7 kDa
• AASequence: WRFWDSNCSTSEMECGSSGTCISSSLWCDGVAHCPNGEDENRCVRLYGQSFILQVYSSQRKAWYPVCQDDWSESYGRAACKDMGYKNNFYSSQGIPDQSGATSFMKLNVSSGNVDLYKKLYHSDSCSSRMVVSLRCIECGVRSVKRQSRIVGGLNASPGDWPWQVSLHVQGVHVCGGSIITPEWIVTAAHCVEEPLSSPRYWTAFAGILRQSLMFYGSRHQVEKVISHPNYDSKTKNNDIALMKLQTPLAFNDLVKPVCLPNPGMMLDLDQECWISGWGATYEKGKTSDVLNAAMVPLIEPSKCNSKYIYNNLITPAMICAGFLQGSVDSCQGDSGGPLVTLKNGIWWLIGDTSWGSGCAKALRPGVYGNVTVFTDWIYQQMRANS
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Tmprss2 transmembrane protease, serine 2 [ Mus musculus ]
• Official Symbol: Tmprss2
• Synonyms: TMPRSS2; transmembrane protease, serine 2; transmembrane protease serine 2; epitheliasin; plasmic transmembrane protein X; D16Ertd61e; MGC6821
• Gene ID: 50528
• mRNA Refseq: NM_015775
• Protein Refseq: NP_056590