Recombinant Human TMPRSS2 protein
Cat.No. : | TMPRSS2-01H |
Product Overview : | Recombinant Human TMPRSS2 protein was expressed in E.coli. |
Availability | March 31, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | This gene encodes a protein that belongs to the serine protease family. The encoded protein contains a type II transmembrane domain, a receptor class A domain, a scavenger receptor cysteine-rich domain and a protease domain. Serine proteases are known to be involved in many physiological and pathological processes. This gene was demonstrated to be up-regulated by androgenic hormones in prostate cancer cells and down-regulated in androgen-independent prostate cancer tissue. The protease domain of this protein is thought to be cleaved and secreted into cell media after autocleavage. This protein also facilitates entry of viruses into host cells by proteolytically cleaving and activating viral envelope glycoproteins. Viruses found to use this protein for cell entry include Influenza virus and the human coronaviruses HCoV-229E, MERS-CoV, SARS-CoV and SARS-CoV-2 (COVID-19 virus). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Form : | 25mM Tris, pH 9.0, 250mM NaCl. |
Molecular Mass : | The protein has a calculated MW of 26.1 kDa. |
AA Sequence : | MIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMR |
Purity : | >90% by SDS-PAGE. |
Storage : | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.22 mg/ml |
Gene Name | TMPRSS2 |
Official Symbol | TMPRSS2 |
Synonyms | PRSS10 |
Gene ID | 7113 |
mRNA Refseq | NM_001135099.1 |
Protein Refseq | NP_001128571.1 |
MIM | 602060 |
UniProt ID | O15393 |
◆ Recombinant Proteins | ||
Tmprss2-428M | Recombinant Mouse Tmprss2 Protein, His-tagged | +Inquiry |
TMPRSS2-6469H | Recombinant Human TMPRSS2 Protein (Ser284-Gly492), His tagged | +Inquiry |
TMPRSS2-05943H | Recombinant Human TMPRSS2 Protein(106-492aa), MBP&His-Avi-tagged, Biotinylated | +Inquiry |
TMPRSS2-4899H | Recombinant Human TMPRSS2 protein, His-tagged | +Inquiry |
Tmprss2-747M | Recombinant Mouse Tmprss2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMPRSS2-910HCL | Recombinant Human TMPRSS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMPRSS2 Products
Required fields are marked with *
My Review for All TMPRSS2 Products
Required fields are marked with *
0
Inquiry Basket