Recombinant Mouse Timp4 protein, His-SUMO-tagged

• Cat.No.: Timp4-5644M
• Product Overview: Recombinant Mouse Timp4 protein(Q9JHB3)(30-224aa), fused with N-terminal His tag and SUMO tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Mouse
• Tag: N-His-SUMO
• Protein length: 30-224aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 35.6 kDa
• AASequence: CSCAPAHPQQHFCHSALVIRAKISSEKVVPASKDPADTQKLIRYEIKQIKMFKGFEKAKDIQYVYTPFDSSLCGVKLETNSHKQYLLTGQILSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHQNCGCQITTCYAVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGICSWYRGHLHLRKEYVDIIQP
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Timp4 tissue inhibitor of metalloproteinase 4 [ Mus musculus ]
• Official Symbol: Timp4
• Synonyms: TIMP4; tissue inhibitor of metalloproteinase 4; metalloproteinase inhibitor 4; tissue inhibitor of metalloproteinases 4; TIMP-4
• Gene ID: 110595
• mRNA Refseq: NM_080639
• Protein Refseq: NP_542370