Recombinant Human TIMP4 protein, His-tagged
Cat.No. : | TIMP4-4002H |
Product Overview : | Recombinant Human TIMP4 protein(1 - 224 aa), fused to His tag, was expressed in E. coli. |
Availability | March 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1 - 224 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MPGSPRPAPSWVLLLRLLALLRPPGLGEACSCAPAHPQQHICHSALVIRAKISSEKVVPASADPADTEKMLRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGTCSWYRGHLPLRKEFVDIVQP |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TIMP4 TIMP metallopeptidase inhibitor 4 [ Homo sapiens ] |
Official Symbol | TIMP4 |
Synonyms | TIMP4; TIMP metallopeptidase inhibitor 4; tissue inhibitor of metalloproteinase 4; metalloproteinase inhibitor 4; TIMP-4; tissue inhibitor of metalloproteinases 4; |
Gene ID | 7079 |
mRNA Refseq | NM_003256 |
Protein Refseq | NP_003247 |
MIM | 601915 |
UniProt ID | Q99727 |
◆ Recombinant Proteins | ||
TIMP4-6459H | Recombinant Human TIMP4 Protein (Cys30-Pro224), C-His tagged | +Inquiry |
TIMP4-27M | Recombinant Human TIMP4 protein, Fc-tagged | +Inquiry |
TIMP4-25H | Recombinant Human TIMP4 protein, Fc-tagged | +Inquiry |
TIMP4-6458H | Recombinant Human TIMP4 Protein (Cys32-Pro224), His tagged | +Inquiry |
TIMP4-5735R | Recombinant Rat TIMP4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TIMP4-1063HCL | Recombinant Human TIMP4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TIMP4 Products
Required fields are marked with *
My Review for All TIMP4 Products
Required fields are marked with *
0
Inquiry Basket