Recombinant Mouse Timp1 Protein, His-tagged

• Cat.No.: Timp1-01M
• Product Overview: Recombinant Mouse TIMP-1 (25-205aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.

Specification

• Species: Mouse
• Source: Insect Cells
• Tag: His
• Description: Metalloproteinase inhibitor that functions by forming one to one complexes with target metalloproteinases, such as collagenases, and irreversibly inactivates them by binding to their catalytic zinc cofactor. Acts on MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16. Does not act on MMP14 (By similarity).
• Form: Liquid
• Molecular Mass: 21 kDa (187aa)
• AA Sequence: CSCAPPHPQTAFCNSDLVIRAKFMGSPEINETTLYQRYKIKMTKMLKGFKAVGNAADIRYAYTPVMESLCGYAHKSQNRSEEFLITGRLRNGNLHISACSFLVPWRTLSPAQQRAFSKTYSAGCGVCTVFPCLSIPCKLESDTHCLWTDQVLVGSEDYQSRHFACLPRNPGLCTWRSLGAR
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 95% by SDS-PAGE
• Applications: SDS-PAGE
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.5 mg/mL (determined by absorbance at 280nm)
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) 10% glycerol

Gene Information

• Gene Name: Timp1 tissue inhibitor of metalloproteinase 1 [ Mus musculus (house mouse) ]
• Official Symbol: Timp1
• Synonyms: Timp1; tissue inhibitor of metalloproteinase 1; Cl; EPA; Clgi; Timp; TIMP-1; TPA-S1; metalloproteinase inhibitor 1; TPA-induced protein; collagenase inhibitor 16C8 fibroblast; erythroid-potentiating activity; tissue inhibitor of metalloproteinases 1
• Gene ID: 21857
• mRNA Refseq: NM_011593
• Protein Refseq: NP_035723
• UniProt ID: P12032