Recombinant Mouse Timp1 protein, His-SUMO-tagged

• Cat.No.: Timp1-3583M
• Product Overview: Recombinant Mouse Timp1 protein(P12032)(25-205aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 25-205aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 36.2 kDa
• AA Sequence: CSCAPPHPQTAFCNSDLVIRAKFMGSPEINETTLYQRYKIKMTKMLKGFKAVGNAADIRYAYTPVMESLCGYAHKSQNRSEEFLITGRLRNGNLHISACSFLVPWRTLSPAQQRAFSKTYSAGCGVCTVFPCLSIPCKLESDTHCLWTDQVLVGSEDYQSRHFACLPRNPGLCTWRSLGAR
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Timp1 tissue inhibitor of metalloproteinase 1 [ Mus musculus ]
• Official Symbol: Timp1
• Synonyms: TIMP1; tissue inhibitor of metalloproteinase 1; metalloproteinase inhibitor 1; EPA; TPA-S1; TPA-induced protein; erythroid-potentiating activity; collagenase inhibitor 16C8 fibroblast; tissue inhibitor of metalloproteinase-1; tissue inhibitor of metalloproteinases 1; Clgi; Timp; TIMP-1; MGC7143
• Gene ID: 21857
• mRNA Refseq: NM_001044384
• Protein Refseq: NP_001037849