Recombinant Mouse THRSP Protein (1-150 aa), His-SUMO-tagged

• Cat.No.: THRSP-1929M
• Product Overview: Recombinant Mouse THRSP Protein (1-150 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length.

Specification

• Description: Plays a role in the regulation of lipogenesis, especially in lactating mammary gland. Important for the biosynthesis of triglycerides with medium-length fatty acid chains. May modulate lipogenesis by interacting with MID1IP1 and preventing its interaction with ACACA. May function as transcriptional coactivator. May modulate the transcription factor activity of THRB.
• Source: E. coli
• Species: Mouse
• Tag: His&SUMO
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 33.1 kDa
• Protein length: 1-150 aa
• AA Sequence: MQVLTKRYPKNCLLTVMDRYSAVVRNMEQVVMIPSLLRDVQLSGPGGSVQDGAPDLYTYFTMLKSICVEVDHGLLPREEWQAKVAGNETSEAENDAAETEEAEEDRISEELDLEAQFHLHFCSLHHILTHLTRKAQEVTRKYQEMTGQVL
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Thrsp thyroid hormone responsive SPOT14 homolog (Rattus) [ Mus musculus ]
• Official Symbol: THRSP
• Synonyms: THRSP; SPOT14; spot 14 protein; S14
• Gene ID: 21835
• mRNA Refseq: NM_009381
• Protein Refseq: NP_033407
• UniProt ID: Q62264