Recombinant Mouse THRSP Protein (1-150 aa), His-SUMO-tagged

Cat.No. : THRSP-1929M
Product Overview : Recombinant Mouse THRSP Protein (1-150 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&SUMO
Protein Length : 1-150 aa
Description : Plays a role in the regulation of lipogenesis, especially in lactating mammary gland. Important for the biosynthesis of triglycerides with medium-length fatty acid chains. May modulate lipogenesis by interacting with MID1IP1 and preventing its interaction with ACACA. May function as transcriptional coactivator. May modulate the transcription factor activity of THRB.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 33.1 kDa
AA Sequence : MQVLTKRYPKNCLLTVMDRYSAVVRNMEQVVMIPSLLRDVQLSGPGGSVQDGAPDLYTYFTMLKSICVEVDHGLLPREEWQAKVAGNETSEAENDAAETEEAEEDRISEELDLEAQFHLHFCSLHHILTHLTRKAQEVTRKYQEMTGQVL
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name Thrsp thyroid hormone responsive SPOT14 homolog (Rattus) [ Mus musculus ]
Official Symbol THRSP
Synonyms THRSP; SPOT14; spot 14 protein; S14;
Gene ID 21835
mRNA Refseq NM_009381
Protein Refseq NP_033407
UniProt ID Q62264

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All THRSP Products

Required fields are marked with *

My Review for All THRSP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon