Recombinant Mouse THBS2 Protein (19-232 aa), His-tagged

Cat.No. : THBS2-1539M
Product Overview : Recombinant Mouse THBS2 Protein (19-232 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Yeast
Tag : His
Protein Length : 19-232 aa
Description : Adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions. Ligand for CD36 mediating antiangiogenic properties.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 26.1 kDa
AA Sequence : GDHVKDTSFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRFDYIPPVNTDDLNRIVKLARRKEGFFLTAQLKQDRKSRGTLLVLEGPGTSQRQFEIVSNGPGDTLDLNYWVEGNQHTNFLEDVGLADSQWKNVTVQVASDTYSLYVGCDLIDSVTLEEPFYEQLEVDRSRMYVAKGASRESHFRGLLQNVHLVFADSVEDILSKKGCQHSQGA
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name Thbs2 thrombospondin 2 [ Mus musculus ]
Official Symbol THBS2
Synonyms THBS2; thrombospondin 2; thrombospondin-2; TSP2; Thbs-2;
Gene ID 21826
mRNA Refseq NM_011581
Protein Refseq NP_035711
UniProt ID Q03350

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All THBS2 Products

Required fields are marked with *

My Review for All THBS2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon